PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539664.1_FGP008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 1490aa    MW: 161239 Da    PI: 6.5388
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539664.1_FGP008genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.41.3e-07636678347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  KN539664.1_FGP008 636 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 678
                        899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.39E-13619681IPR009057Homeodomain-like
PROSITE profilePS5129314.547632683IPR017884SANT domain
SMARTSM007174.8E-7633681IPR001005SANT/Myb domain
PfamPF002498.7E-6636678IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-5636680IPR009057Homeodomain-like
PROSITE profilePS5129313.728841892IPR017884SANT domain
SMARTSM007176.6E-4842890IPR001005SANT/Myb domain
CDDcd001670.00113846884No hitNo description
SuperFamilySSF466891.33E-8846892IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1490 aa     Download sequence    Send to blast
MRGSYRRSPF RGYGSDFSRN HQEHPPPPLR RSPLRSVAVP MSYDPPGDRA DRGDRDHHHR  60
VTPWRPLRRR ESRSDAADAA GAGPVPVGQA AAAAASEKDV SARSSAVAAP QVSEEEAPRK  120
KPRLGWGQGL AKYEKQKVQG PAESAEAVAE GSPTATEQKG VTHTPAPAPC ASPVAAPSPA  180
PCASPVAAPS PAPPCKSPVA EDKSCELTAN TVTESNKNIP GPDVQACNNE IPTKLDQLEG  240
DPIDSLAKVL SELVQHEDSC SGDSKRLSNV SKLLLLKESI SKELEKTELE IDSLEGELKS  300
VNVEARNRAL KDPPTAVTYA QNPSPSPVKE QGELTPSPKI SMEQDADVKG SELMEVETAQ  360
AHNAKAVSSE ESVACPGVAP GQVPAAADVI PSDPCGKTGS GIDVDIEQRE ENPCQENFNA  420
MKADGSSDLA TRPCSYRDVK YNLMDQIIAA NRSEAKKNSQ LLFKPMPADR SNLDLLASSY  480
LSSQMKNDVI IKKKHAILKN RQRFKEQILT FKFRVLRHLW KEDVRLLSVR KQRSKSHKRT  540
DQSNRSSQSG SQRQRSSNRS RLAVPAGNLS TFPITEMSGV AKKLFSEFQL KRCRNYLKMP  600
ALIVDEKEKA GAKFVSKNGL VEDPVSVEKE RALINPWIQE EKEIFMEKLA TFGKDFSKIS  660
SFLQHKTTAD CIEFYYKHHK SDSFREVKKL LDLRQQQQPA SNYLGAVSGK KWNPESNAAS  720
LDMLGVATEV AAQGLEYVNE VKKNSAKSIL RTVCGVDNST KGSEKDCVGD VSLHERESVA  780
ADVLAGICGT LSPEGMGSCI TSSADLGQKI GIISRMEHLL TPEADKNFDD DGTLSDQECE  840
VDIVDWNDDE KSSFIEAMNR YGKDFARISS YVKSKSFEQC KVFFSKARKS LGLDLIHQGA  900
ADAGFPTGDA NGGRSGTDGA CIAEMDSAIC SAQSCPKVEI DACPVSDGEI QGHNSLSDIA  960
SRQPEADRSN MPDVVDINVE EGESKAEKDC SILVDHKQLR EDTNQTSCAR IDINCPESTD  1020
KLQDIEDDVT PVNMHGDDLM ATSVEQAAAA HVESRSSLHS EGIGIDVSRI EGCSHESTIG  1080
KGGKSTPSVC LPAANGVSKE NIIHFSNMDG ASSISPAFTS NYQQSKLADP IQSKPKPLTP  1140
KDLMPVQFSS SLPDPTSICF EGIAAITTPN FEDHGNRASI ASGAKDVNMF PTFKDQSSNR  1200
HDALFSNVDG YMQQRRNNHF GTEVCGLSES TGISQSDQFT VSKFQNGRPS SLGLSNGNLG  1260
VLSTGRREEA REGLFRPCSV KTSAGNEEQQ KRPGDVKLFG QILSHQSSMQ SSGSSVHGSK  1320
SKPPSPKVDK SASSRLLSNP RERLVYSSRP PIIANLGLEE RAMRSFDHMD GRTIQPEPMV  1380
MVAKCQRPSA GVPVYSTKNG ALSVFAEFQQ PSMPPHTSDH KLLENFADLH KRNGIELLSG  1440
FQQPGRLGGA GVLVSGVSDP VAALKAQYGS GSKMLSSSND VDSWKDIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C4e-16594685494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D4e-16594685494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297200.0AC129720.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone P0683F12, complete sequence.
GenBankAC1349310.0AC134931.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBb0079L11, complete sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA2XZX70.0A2XZX7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018896-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-75MYB family protein